Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB31351 |
Product name: | HPGD polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human HPGD. |
Isotype: | IgG |
Gene id: | 3248 |
Gene name: | HPGD |
Gene alias: | 15-PGDH|PGDH|PGDH1|SDR36C1 |
Gene description: | hydroxyprostaglandin dehydrogenase 15-(NAD) |
Immunogen: | Recombinant protein corresponding to human HPGD. |
Immunogen sequence/protein sequence: | VDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV |
Protein accession: | P15428 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with HPGD polyclonal antibody (Cat # PAB31351) shows strong cytoplasmic and membranous positivity in glandular cells. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |
Publications: | Characterization of transcriptional changes in ERG rearrangement-positive prostate cancer identifies the regulation of metabolic sensors such as neuropeptide Y.Massoner P, Kugler KG, Unterberger K, Kuner R, Mueller LA, Falth M, Schafer G, Seifarth C, Ecker S, Verdorfer I, Graber A, Sultmann H, Klocker H. PLoS One. 2013;8(2):e55207. doi: 10.1371/journal.pone.0055207. Epub 2013 Feb 4. |