View larger

CLEC4D polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLEC4D polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about CLEC4D polyclonal antibody

Brand: Abnova
Reference: PAB31350
Product name: CLEC4D polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CLEC4D.
Isotype: IgG
Gene id: 338339
Gene name: CLEC4D
Gene alias: CLEC-6|CLEC6|CLECSF8|MCL|MGC40078|MPCL
Gene description: C-type lectin domain family 4, member D
Immunogen: Recombinant protein corresponding to human CLEC4D.
Immunogen sequence/protein sequence: KLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRR
Protein accession: Q8WXI8
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31350-48-306-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human oral mucosa with CLEC4D polyclonal antibody (Cat # PAB31350) shows strong cytoplasmic positivity in squamous epithelial cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLEC4D polyclonal antibody now

Add to cart