View larger

UCKL1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UCKL1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about UCKL1 polyclonal antibody

Brand: Abnova
Reference: PAB31291
Product name: UCKL1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human UCKL1.
Isotype: IgG
Gene id: 54963
Gene name: UCKL1
Gene alias: UCK1-LIKE|UCK1L|URKL1
Gene description: uridine-cytidine kinase 1-like 1
Immunogen: Recombinant protein corresponding to amino acids 86-203 of human UCKL1.
Immunogen sequence/protein sequence: PWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGANVI
Protein accession: Q9NWZ5
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31291-48-4-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach shows strong cytoplasmic positivity in glandular cells.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy UCKL1 polyclonal antibody now

Add to cart