Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CX3CL1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about CX3CL1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31233 |
| Product name: | CX3CL1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human CX3CL1. |
| Isotype: | IgG |
| Gene id: | 6376 |
| Gene name: | CX3CL1 |
| Gene alias: | ABCD-3|C3Xkine|CXC3|CXC3C|NTN|NTT|SCYD1|fractalkine|neurotactin |
| Gene description: | chemokine (C-X3-C motif) ligand 1 |
| Immunogen: | Recombinant protein corresponding to human CX3CL1. |
| Immunogen sequence/protein sequence: | GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE |
| Protein accession: | P78423 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with CX3CL1 polyclonal antibody (Cat # PAB31233) shows strong cytoplasmic positivity with granular pattern in glandular cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | The Ovarian Cancer Chemokine Landscape Is Conducive to Homing of Vaccine-Primed and CD3/CD28-Costimulated T Cells Prepared for Adoptive Therapy.Zsiros E, Duttagupta P, Dangaj D, Li H, Frank R, Garrabrant T, Hagemann IS, Levine BL, June CH, Zhang L, Wang E, Marincola FM, Bedognetti D, Powell DJ Jr, Tanyi J, Feldman MD, Kandalaft LE, Coukos G. Clin Cancer Res. 2015 Jun 15;21(12):2840-50. doi: 10.1158/1078-0432.CCR-14-2777. Epub 2015 Feb 23. |