View larger

NRIP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NRIP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about NRIP2 polyclonal antibody

Brand: Abnova
Reference: PAB31224
Product name: NRIP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human NRIP2.
Isotype: IgG
Gene id: 83714
Gene name: NRIP2
Gene alias: DKFZp761G1913
Gene description: nuclear receptor interacting protein 2
Immunogen: Recombinant protein corresponding to human NRIP2.
Immunogen sequence/protein sequence: LDSLKRLGTSKDLQPRSVIQRRLVEGNPNWLQGEPPRMQDLIHGQESRRKTSRTEIPALLVNCKCQDQLLRV
Protein accession: Q9BQI9
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31224-48-52-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with NRIP2 polyclonal antibody (Cat # PAB31224) shows strong nuclear positivity in granular layer.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy NRIP2 polyclonal antibody now

Add to cart