Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB31203 |
Product name: | AXL polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human AXL. |
Isotype: | IgG |
Gene id: | 558 |
Gene name: | AXL |
Gene alias: | JTK11|UFO |
Gene description: | AXL receptor tyrosine kinase |
Immunogen: | Recombinant protein corresponding to human AXL. |
Immunogen sequence/protein sequence: | PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ |
Protein accession: | P30530 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with AXL polyclonal antibody (Cat # PAB31203) shows strong cytoplasmic positivity in cells in seminiferous ducts. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | The prognostic value of the stem-like group in colorectal cancer using a panel of immunohistochemistry markers.Ong CW, Chong PY, McArt DG, Chan JY, Tan HT, Kumar AP, Chung MC, Cl?ment MV, Soong R, Van Schaeybroeck S, Waugh DJ, Johnston PG, Dunne PD, Salto-Tellez M. Oncotarget. 2015 May 20;6(14):12763-73. |