View larger

SPPL2A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPPL2A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SPPL2A polyclonal antibody

Brand: Abnova
Reference: PAB31196
Product name: SPPL2A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SPPL2A.
Isotype: IgG
Gene id: 84888
Gene name: SPPL2A
Gene alias: IMP3|PSL2
Gene description: signal peptide peptidase-like 2A
Immunogen: Recombinant protein corresponding to human SPPL2A.
Immunogen sequence/protein sequence: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE
Protein accession: Q8TCT8
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31196-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SPPL2A polyclonal antibody (Cat # PAB31196) shows strong granular cytoplasmic positivity in cells of tubules.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SPPL2A polyclonal antibody now

Add to cart