Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB31189 |
Product name: | CD99 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human CD99. |
Isotype: | IgG |
Gene id: | 4267 |
Gene name: | CD99 |
Gene alias: | MIC2|MIC2X|MIC2Y |
Gene description: | CD99 molecule |
Immunogen: | Recombinant protein corresponding to human CD99. |
Immunogen sequence/protein sequence: | SSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLL |
Protein accession: | P14209 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with CD99 polyclonal antibody (Cat # PAB31189) shows membranous positivity in islets of Langerhans. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | CD99 is a novel prognostic stromal marker in non-small cell lung cancer.Edlund K, Lindskog C, Saito A, Berglund A, Ponten F, Goransson-Kultima H, Isaksson A, Jirstrom K, Planck M, Johansson L, Lambe M, Holmberg L, Nyberg F, Ekman S, Bergqvist M, Landelius P, Lamberg K, Botling J, Ostman A, Micke P. Int J Cancer. 2012 Nov 15;131(10):2264-73. doi: 10.1002/ijc.27518. Epub 2012 Apr 24. |