Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB31181 |
Product name: | TENC1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human TENC1. |
Isotype: | IgG |
Gene id: | 23371 |
Gene name: | TENC1 |
Gene alias: | C1-TEN|C1TEN|DKFZp686D13244|FLJ16320|KIAA1075|TNS2 |
Gene description: | tensin like C1 domain containing phosphatase (tensin 2) |
Immunogen: | Recombinant protein corresponding to human TENC1. |
Immunogen sequence/protein sequence: | VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN |
Protein accession: | Q63HR2 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with TENC1 polyclonal antibody (Cat # PAB31181) shows moderate cytoplasmic positivity in hepatocytes. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | Transcriptional profiling of human glioblastoma vessels indicates a key role of VEGF-A and TGFβ2 in vascular abnormalization.Dieterich LC, Mellberg S, Langenkamp E, Zhang L, Zieba A, Salomaki H, Teichert M, Huang H, Edqvist PH, Kraus T, Augustin HG, Olofsson T, Larsson E, Soderberg O, Molema G, Ponten F, Georgii-Hemming P, Alafuzoff I, Dimberg A. J Pathol. 2012 Nov;228(3):378-90. doi: 10.1002/path.4072. Epub 2012 Aug 31. |