View larger

PLEKHM2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLEKHM2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about PLEKHM2 polyclonal antibody

Brand: Abnova
Reference: PAB31179
Product name: PLEKHM2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human PLEKHM2.
Isotype: IgG
Gene id: 23207
Gene name: PLEKHM2
Gene alias: KIAA0842|RP11-169K16.1|SKIP
Gene description: pleckstrin homology domain containing, family M (with RUN domain) member 2
Immunogen: Recombinant protein corresponding to human PLEKHM2.
Immunogen sequence/protein sequence: GTQEVLCQLKRDQPSPCLSSAEDSGVDEGQGSPSEMVHSSEFRVDNNHLLLLMIHVFRENEEQLFKMIRMSTGHMEGNLQLLYVLLTDCYVYLLRKGATEKPYLVEEAVSYNELDYVSV
Protein accession: Q8IWE5
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31179-48-39-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human urinary bladder with PLEKHM2 polyclonal antibody (Cat # PAB31179) shows strong cytoplasmic and nuclear positivity in urothelial cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy PLEKHM2 polyclonal antibody now

Add to cart