Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB31159 |
Product name: | PTPN5 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human PTPN5. |
Isotype: | IgG |
Gene id: | 84867 |
Gene name: | PTPN5 |
Gene alias: | FLJ14427|PTPSTEP|STEP |
Gene description: | protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) |
Immunogen: | Recombinant protein corresponding to human PTPN5. |
Immunogen sequence/protein sequence: | PEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGL |
Protein accession: | P54829 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lateral ventricle with PTPN5 polyclonal antibody (Cat # PAB31159) shows moderate cytoplasmic and nuclear positivity in neuronal cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |