Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB31149 |
Product name: | LGR4 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human LGR4. |
Isotype: | IgG |
Gene id: | 55366 |
Gene name: | LGR4 |
Gene alias: | GPR48 |
Gene description: | leucine-rich repeat-containing G protein-coupled receptor 4 |
Immunogen: | Recombinant protein corresponding to human LGR4. |
Immunogen sequence/protein sequence: | KSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD |
Protein accession: | Q9BXB1 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast with LGR4 polyclonal antibody (Cat # PAB31149) shows strong positivity in glandular cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | LGR4 and LGR6 are differentially expressed and of putative tumor biological significance in gastric carcinoma.Steffen JS, Simon E, Warneke V, Balschun K, Ebert M, R?cken C. Virchows Arch. 2012 Oct;461(4):355-65. doi: 10.1007/s00428-012-1292-1. Epub 2012 Aug 2. |