Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SNX26 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about SNX26 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31143 |
| Product name: | SNX26 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human SNX26. |
| Isotype: | IgG |
| Gene id: | 115703 |
| Gene name: | SNX26 |
| Gene alias: | FLJ39019|TCGAP |
| Gene description: | sorting nexin 26 |
| Immunogen: | Recombinant protein corresponding to human SNX26. |
| Immunogen sequence/protein sequence: | PSECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQRLRQRGIL |
| Protein accession: | O14559 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human adrenal gland with SNX26 polyclonal antibody (Cat # PAB31143) shows cytoplasmic positivity in cortical cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Emerging roles of ARHGAP33 in intracellular trafficking of TrkB and pathophysiology of neuropsychiatric disorders.Nakazawa T, Hashimoto R, Sakoori K, Sugaya Y, Tanimura A, Hashimotodani Y, Ohi K, Yamamori H, Yasuda Y, Umeda-Yano S, Kiyama Y, Konno K, Inoue T, Yokoyama K, Inoue T, Numata S, Ohnuma T, Iwata N, Ozaki N, Hashimoto H, Watanabe M, Manabe T, Yamamoto T, Takeda M, Kano M. Nat Commun. 2016 Feb 3;7:10594. doi: 10.1038/ncomms10594. |