View larger

LTB4R2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LTB4R2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about LTB4R2 polyclonal antibody

Brand: Abnova
Reference: PAB31136
Product name: LTB4R2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human LTB4R2.
Isotype: IgG
Gene id: 56413
Gene name: LTB4R2
Gene alias: BLT2|BLTR2|JULF2|KPG_004|NOP9
Gene description: leukotriene B4 receptor 2
Immunogen: Recombinant protein corresponding to human LTB4R2.
Immunogen sequence/protein sequence: MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR
Protein accession: Q9NPC1
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31136-48-303-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human fallopian tube with LTB4R2 polyclonal antibody (Cat # PAB31136) shows distinct positivity in ciliated cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy LTB4R2 polyclonal antibody now

Add to cart