Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTPRA polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about PTPRA polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31129 |
| Product name: | PTPRA polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human PTPRA. |
| Isotype: | IgG |
| Gene id: | 5786 |
| Gene name: | PTPRA |
| Gene alias: | HEPTP|HLPR|HPTPA|HPTPalpha|LRP|PTPA|PTPRL2|R-PTP-alpha|RPTPA |
| Gene description: | protein tyrosine phosphatase, receptor type, A |
| Immunogen: | Recombinant protein corresponding to human PTPRA. |
| Immunogen sequence/protein sequence: | IWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGM |
| Protein accession: | P18433 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cardiac muscle with PTPRA polyclonal antibody (Cat # PAB31129) shows strong cytoplasmic positivity in myocytes. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Neuroblastoma tumorigenesis is regulated through the Nm23-H1/h-Prune C-terminal interaction.Carotenuto M, Pedone E, Diana D, de Antonellis P, D?eroski S, Marino N, Navas L, Di Dato V, Scoppettuolo MN, Cimmino F, Correale S, Pirone L, Monti SM, Bruder E, Zenko B, Slavkov I, Pastorino F, Ponzoni M, Schulte JH, Schramm A, Eggert A, Westermann F, Arrigoni G, Accordi B, Basso G, Saviano M, Fattorusso R, Zollo M. Sci Rep. 2013;3:1351. doi: 10.1038/srep01351. |