Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB31128 |
Product name: | SENP2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human SENP2. |
Isotype: | IgG |
Gene id: | 59343 |
Gene name: | SENP2 |
Gene alias: | AXAM2|DKFZp762A2316|KIAA1331|SMT3IP2 |
Gene description: | SUMO1/sentrin/SMT3 specific peptidase 2 |
Immunogen: | Recombinant protein corresponding to human SENP2. |
Immunogen sequence/protein sequence: | RRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKL |
Protein accession: | Q9HC62 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with SENP2 polyclonal antibody (Cat # PAB31128) shows strong cytoplasmic positivity in exocrine glandular cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | Integrative genomics analysis identifies candidate drivers at 3q26-29 amplicon in squamous cell carcinoma of the lung.Wang J, Qian J, Hoeksema MD, Zou Y, Espinosa AV, Rahman SM, Zhang B, Massion PP. Clin Cancer Res. 2013 Oct 15;19(20):5580-90. doi: 10.1158/1078-0432.CCR-13-0594. Epub 2013 Aug 1. |