View larger

FGF11 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGF11 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF

More info about FGF11 polyclonal antibody

Brand: Abnova
Reference: PAB31106
Product name: FGF11 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombiant human FGF11.
Isotype: IgG
Gene id: 2256
Gene name: FGF11
Gene alias: FHF3|FLJ16061|MGC102953|MGC45269
Gene description: fibroblast growth factor 11
Immunogen: Recombinant protein corresponding to human FGF11.
Immunogen sequence/protein sequence: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN
Protein accession: Q92914
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31106-49-109-1.jpg
Application image note: Immunofluorescent staining of HaCaT cell line with antibody shows positivity in centrosome (green).
Applications: IF
Shipping condition: Dry Ice

Reviews

Buy FGF11 polyclonal antibody now

Add to cart