Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IF |
Brand: | Abnova |
Reference: | PAB31106 |
Product name: | FGF11 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombiant human FGF11. |
Isotype: | IgG |
Gene id: | 2256 |
Gene name: | FGF11 |
Gene alias: | FHF3|FLJ16061|MGC102953|MGC45269 |
Gene description: | fibroblast growth factor 11 |
Immunogen: | Recombinant protein corresponding to human FGF11. |
Immunogen sequence/protein sequence: | VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN |
Protein accession: | Q92914 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunofluorescent staining of HaCaT cell line with antibody shows positivity in centrosome (green). |
Applications: | IF |
Shipping condition: | Dry Ice |