Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IF |
Brand: | Abnova |
Reference: | PAB31105 |
Product name: | PIK3CB polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombiant human PIK3CB. |
Isotype: | IgG |
Gene id: | 5291 |
Gene name: | PIK3CB |
Gene alias: | DKFZp779K1237|MGC133043|PI3K|PI3KCB|PI3Kbeta|PIK3C1|p110-BETA |
Gene description: | phosphoinositide-3-kinase, catalytic, beta polypeptide |
Immunogen: | Recombinant protein corresponding to human PIK3CB. |
Immunogen sequence/protein sequence: | LSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGK |
Protein accession: | P42338 |
Form: | Liquid |
Recommend dilutions: | Western Blot (1:500-1000) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of SK-MEL-30 cell line with antibody shows positivity in nucleoplasma (green). |
Applications: | WB,IF |
Shipping condition: | Dry Ice |