Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UCHL1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,IHC-P,IF |
More info about UCHL1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31090 |
| Product name: | UCHL1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombiant human UCHL1. |
| Isotype: | IgG |
| Gene id: | 7345 |
| Gene name: | UCHL1 |
| Gene alias: | PARK5|PGP9.5|Uch-L1 |
| Gene description: | ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) |
| Immunogen: | Recombinant protein corresponding to human UCHL1. |
| Immunogen sequence/protein sequence: | QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL |
| Protein accession: | P09936 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-5000) Western Blot (1:500-1000) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescent staining of U-251MG cell line with antibody shows positivity in nucleoplasm and cytosol (green). |
| Applications: | WB-Ce,WB-Ti,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | The prognostic potential and oncogenic effects of PRR11 expression in hilar cholangiocarcinoma.Chen Y, Cha Z, Fang W, Qian B, Yu W, Li W, Yu G, Gao Y. Oncotarget. 2015 Aug 21; 6(24): 20419–20433. |