Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB31079 |
Product name: | USP33 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombiant human USP33. |
Isotype: | IgG |
Gene id: | 23032 |
Gene name: | USP33 |
Gene alias: | KIAA1097|MGC16868|VDU1 |
Gene description: | ubiquitin specific peptidase 33 |
Immunogen: | Recombinant protein corresponding to human USP33. |
Immunogen sequence/protein sequence: | ESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALS |
Protein accession: | Q8TEY7 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000) Western Blot (1:100-250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of RH-30 cell line with antibody shows positivity in nucleoplasm and the Golgi apparatus (green). |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |