Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB31074 |
Product name: | NDUFB5 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombiant human NDUFB5. |
Isotype: | IgG |
Gene id: | 4711 |
Gene name: | NDUFB5 |
Gene alias: | CI-SGDH|DKFZp686N02262|FLJ30597|MGC111204|MGC12314|SGDH |
Gene description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa |
Immunogen: | Recombinant protein corresponding to human NDUFB5. |
Immunogen sequence/protein sequence: | EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN |
Protein accession: | O43674 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200) Western Blot (1:100-250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of U-2 OS cell line with antibody shows positivity in nucleoplasm and mitochondria (green). |
Applications: | WB,IHC-P,IF |
Shipping condition: | Dry Ice |
Publications: | p16(Ink4a)-induced senescence of pancreatic beta cells enhances insulin secretion.Aharon Helman, Agnes Klochendler, Narmen Azazmeh, Yael Gabai, Elad Horwitz, Shira Anzi, Avital Swisa, Reba Condiotti, Roy Z Granit, Yuval Nevo, Yaakov Fixler, Dorin Shreibman, Amit Zamir, Sharona Tornovsky-Babeay, Chunhua Dai, Benjamin Glaser, Alvin C Powers, A M James Shapiro, Mark A Magnuson, Yuval Dor, Ittai Ben-Porath. Nat Med.?2016 Apr;22(4):412-20. |