Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IF |
Brand: | Abnova |
Reference: | PAB31069 |
Product name: | BRCA2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombiant human BRCA2. |
Isotype: | IgG |
Gene id: | 675 |
Gene name: | BRCA2 |
Gene alias: | BRCC2|FACD|FAD|FAD1|FANCB|FANCD|FANCD1 |
Gene description: | breast cancer 2, early onset |
Immunogen: | Recombinant protein corresponding to human BRCA2. |
Immunogen sequence/protein sequence: | VHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLS |
Protein accession: | P51587 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of U-251MG cell line with antibody shows positivity in nucleoplasm and cytosol (green). |
Applications: | IF |
Shipping condition: | Dry Ice |
Publications: | 53BP1 fosters fidelity of homology-directed DNA repair.Fena Ochs, Kumar Somyajit, Matthias Altmeyer, Maj-Britt Rask, Jiri Lukas, Claudia Lukas. Nat Struct Mol Biol. 2016 Aug;23(8):714-21. |