View larger

WNT8A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WNT8A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about WNT8A polyclonal antibody

Brand: Abnova
Reference: PAB31067
Product name: WNT8A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombiant human WNT8A.
Isotype: IgG
Gene id: 7478
Gene name: WNT8A
Gene alias: WNT8D
Gene description: wingless-type MMTV integration site family, member 8A
Immunogen: Recombinant protein corresponding to human WNT8A.
Immunogen sequence/protein sequence: MGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNT
Protein accession: Q9H1J5
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31067-51-89-1.jpg
Application image note: Western Blot (Cell lysate) analysis of (1) Negative control (vector only transfected HEK293T lysate), and (2) Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WNT8A polyclonal antibody now

Add to cart