View larger

PRKCG polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKCG polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about PRKCG polyclonal antibody

Brand: Abnova
Reference: PAB31057
Product name: PRKCG polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombiant human PRKCG.
Isotype: IgG
Gene id: 5582
Gene name: PRKCG
Gene alias: MGC57564|PKC-gamma|PKCC|PKCG|SCA14
Gene description: protein kinase C, gamma
Immunogen: Recombinant protein corresponding to human PRKCG.
Immunogen sequence/protein sequence: GEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIP
Protein accession: P05129
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31057-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy PRKCG polyclonal antibody now

Add to cart