View larger

RALGDS polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RALGDS polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about RALGDS polyclonal antibody

Brand: Abnova
Reference: PAB31054
Product name: RALGDS polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombiant human RALGDS.
Isotype: IgG
Gene id: 5900
Gene name: RALGDS
Gene alias: FLJ20922|RGF|RalGEF
Gene description: ral guanine nucleotide dissociation stimulator
Immunogen: Recombinant protein corresponding to human RALGDS.
Immunogen sequence/protein sequence: CNNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNTLRTKKNTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSS
Protein accession: Q12967
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31054-49-23-1.jpg
Application image note: Immunofluorescent staining of U-2 OS cell line with antibody shows positivity in nucleus (green).
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy RALGDS polyclonal antibody now

Add to cart