Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EML4 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P,IF |
More info about EML4 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31053 |
| Product name: | EML4 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombiant human EML4. |
| Isotype: | IgG |
| Gene id: | 27436 |
| Gene name: | EML4 |
| Gene alias: | C2orf2|DKFZp686P18118|ELP120|FLJ10942|FLJ32318|ROPP120 |
| Gene description: | echinoderm microtubule associated protein like 4 |
| Immunogen: | Recombinant protein corresponding to human EML4. |
| Immunogen sequence/protein sequence: | MSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTPPPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEES |
| Protein accession: | Q9HC35 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-2500) Western Blot (1:100-250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of U-251MG cell line with antibody shows positivity in cytosol, intermediate filaments and microtubules (green). |
| Applications: | WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | Neural differentiation modulates the vertebrate brain specific splicing program.Madgwick A, Fort P, Hanson PS, Thibault P, Gaudreau MC, Lutfalla G, Moroy T, Abou Elela S, Chaudhry B, Elliott DJ, Morris CM, Venables JP. PLoS One. 2015; 10(5): e0125998. |