View larger

SLC30A9 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC30A9 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SLC30A9 polyclonal antibody

Brand: Abnova
Reference: PAB30365
Product name: SLC30A9 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SLC30A9.
Isotype: IgG
Gene id: 10463
Gene name: SLC30A9
Gene alias: C4orf1|GAC63|HUEL|ZNT9
Gene description: solute carrier family 30 (zinc transporter), member 9
Immunogen: Recombinant protein corresponding to human SLC30A9.
Immunogen sequence/protein sequence: HRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNVVPCSHPYIGTLSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGAELKAPLKQEPLQVRVKAVLKKREYGSKYTQNNFITGV
Protein accession: Q6PML9
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB30365-48-47-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human adrenal gland with SLC30A9 polyclonal antibody (Cat # PAB30365) shows strong cytoplasmic positivity in cortical cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SLC30A9 polyclonal antibody now

Add to cart