Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,IF |
Brand: | Abnova |
Reference: | PAB27464 |
Product name: | ANKHD1-EIF4EBP3 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant ANKHD1-EIF4EBP3. |
Isotype: | IgG |
Gene id: | 404734 |
Gene name: | ANKHD1-EIF4EBP3 |
Gene alias: | MASK-BP3|MASK-BP3arf |
Gene description: | ANKHD1-EIF4EBP3 readthrough transcript |
Immunogen: | Recombinant protein corresponding to amino acids of human ANKHD1-EIF4EBP3. |
Immunogen sequence/protein sequence: | QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunohistochemical staining of human cerebral cortex with ANKHD1-EIF4EBP3 polyclonal antibody (Cat # PAB27464) shows strong cytoplasmic positivity in neuronal cells. |
Applications: | IHC-P,IF |
Shipping condition: | Dry Ice |