View larger

C17orf64 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C17orf64 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about C17orf64 polyclonal antibody

Brand: Abnova
Reference: PAB24065
Product name: C17orf64 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C17orf64.
Isotype: IgG
Gene id: 124773
Gene name: C17orf64
Gene alias: -
Gene description: chromosome 17 open reading frame 64
Immunogen: Recombinant protein corresponding to amino acids of human C17orf64.
Immunogen sequence/protein sequence: LHSNISGMKERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE
Protein accession: Q86WR6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB24065-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with C17orf64 polyclonal antibody (Cat # PAB24065) shows strong cytoplasmic positivity in exocrine glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C17orf64 polyclonal antibody now

Add to cart