View larger

C12orf73 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C12orf73 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about C12orf73 polyclonal antibody

Brand: Abnova
Reference: PAB23509
Product name: C12orf73 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C12orf73.
Isotype: IgG
Gene id: 728568
Gene name: C12orf73
Gene alias: DKFZp547P055|FLJ13975
Gene description: chromosome 12 open reading frame 73
Immunogen: Recombinant protein corresponding to amino acids of human C12orf73.
Immunogen sequence/protein sequence: AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL
Protein accession: Q69YU5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23509-48-36-1.jpg
Application image note: Immunohistochemical staining of human small intestine with C12orf73 polyclonal antibody (Cat # PAB23509) shows strong cytoplasmic and membranous positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy C12orf73 polyclonal antibody now

Add to cart