View larger

CNPY2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNPY2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about CNPY2 polyclonal antibody

Brand: Abnova
Reference: PAB23291
Product name: CNPY2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CNPY2.
Isotype: IgG
Gene id: 10330
Gene name: CNPY2
Gene alias: HP10390|MSAP|TMEM4|ZSIG9
Gene description: canopy 2 homolog (zebrafish)
Immunogen: Recombinant protein corresponding to amino acids of human CNPY2.
Immunogen sequence/protein sequence: RRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRIDSD
Protein accession: Q9Y2B0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23291-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with CNPY2 polyclonal antibody (Cat # PAB23291) shows strong cytoplasmic positivity in trophoblastic cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CNPY2 polyclonal antibody now

Add to cart