View larger

GPR137C polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPR137C polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about GPR137C polyclonal antibody

Brand: Abnova
Reference: PAB22484
Product name: GPR137C polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GPR137C.
Isotype: IgG
Gene id: 283554
Gene name: GPR137C
Gene alias: DKFZp762F0713|TM7SF1L2
Gene description: G protein-coupled receptor 137C
Immunogen: Recombinant protein corresponding to amino acids of human GPR137C.
Immunogen sequence/protein sequence: RAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAP
Protein accession: Q8N3F9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22484-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with GPR137C polyclonal antibody (Cat # PAB22484) shows strong cytoplasmic positivity in granular pattern in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy GPR137C polyclonal antibody now

Add to cart