Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB22157 |
Product name: | ZNF326 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant ZNF326. |
Isotype: | IgG |
Gene id: | 284695 |
Gene name: | ZNF326 |
Gene alias: | FLJ20403|MGC61591|ZAN75|Zfp326|dJ871E2.1 |
Gene description: | zinc finger protein 326 |
Immunogen: | Recombinant protein corresponding to amino acids of human ZNF326. |
Immunogen sequence/protein sequence: | RNYDAFGGPSTGRGRGRGHMGDFGSIHRPGIVVDYQNKSTNVTVAAARGIKRKMMQPFNKPSGTFIKKPKLAKPMEKI |
Protein accession: | Q5BKZ1 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human gallbladder with ZNF326 polyclonal antibody (Cat # PAB22157) shows strong nuclear and cytoplasmic positivity in glandular cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |