View larger

LY6K polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LY6K polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about LY6K polyclonal antibody

Brand: Abnova
Reference: PAB21148
Product name: LY6K polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LY6K.
Isotype: IgG
Gene id: 54742
Gene name: LY6K
Gene alias: FLJ35226|HSJ001348
Gene description: lymphocyte antigen 6 complex, locus K
Immunogen: Recombinant protein corresponding to amino acids of human LY6K.
Immunogen sequence/protein sequence: TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG
Protein accession: Q17RY6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21148-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251MG with LY6K polyclonal antibody (Cat # PAB21148) at 1-4 ug/mL dilution shows positivity in plasma membrane and cytoplasm.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy LY6K polyclonal antibody now

Add to cart