View larger

C9orf91 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C9orf91 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about C9orf91 polyclonal antibody

Brand: Abnova
Reference: PAB21144
Product name: C9orf91 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C9orf91.
Isotype: IgG
Gene id: 203197
Gene name: C9orf91
Gene alias: DKFZp547P234|FLJ38045|MGC129868|MGC129869|RP11-402G3.2
Gene description: chromosome 9 open reading frame 91
Immunogen: Recombinant protein corresponding to amino acids of human C9orf91.
Immunogen sequence/protein sequence: SVIQLWFVYFDLENCVQFLSDHVQEMKTSQESLLRSRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEAEPEEMARQLLAVFGGYYIRLLVTSQ
Protein accession: Q5VZI3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21144-48-33-1.jpg
Application image note: Immunohistochemical staining of human prostate with C9orf91 polyclonal antibody (Cat # PAB21144) strong cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C9orf91 polyclonal antibody now

Add to cart