View larger

Apoa2 (Mouse) Recombinant Protein

P4028_25 ug

New product

374,00 € tax excl.

25 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Apoa2 (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about Apoa2 (Mouse) Recombinant Protein

Brand: Abnova
Reference: P4028
Product name: Apoa2 (Mouse) Recombinant Protein
Product description: Mouse Apoa2 full-length ORF (NP_038502, 24 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 11807
Gene name: Apoa2
Gene alias: Alp-2|ApoA-II|ApoAII|Apoa-2|Hdl-1
Gene description: apolipoprotein A-II
Genbank accession: NM_013474.2
Immunogen sequence/protein sequence: QADGPDMQSLFTQYFQSMTEYGKDLVEKAKTSEIQSQVKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK
Protein accession: NP_038502
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-P4028-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Mouse
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy Apoa2 (Mouse) Recombinant Protein now

Add to cart