CS monoclonal antibody, clone CL2553 View larger

CS monoclonal antibody, clone CL2553

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CS monoclonal antibody, clone CL2553

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF

More info about CS monoclonal antibody, clone CL2553

Brand: Abnova
Reference: MAB15756
Product name: CS monoclonal antibody, clone CL2553
Product description: Mouse monoclonal antibody raised against partial recombinant human CS.
Clone: CL2553
Isotype: IgG1
Gene id: 1431
Gene name: CS
Gene alias: -
Gene description: citrate synthase
Immunogen: Recombinant protein corresponding to human CS.
Immunogen sequence/protein sequence: ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL
Protein accession: O75390
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15756-49-1-1.jpg
Application image note: Immunofluorescent staining of HeLa cells with CS monoclonal antibody, clone CL2553 (Cat # MAB15756) (Green) shows specific mitochondrial. Microtubule and nuclear probes are visualized in red and blue respectively (where available).
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CS monoclonal antibody, clone CL2553 now

Add to cart