Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ZYX monoclonal antibody, clone CL2502
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF |
More info about ZYX monoclonal antibody, clone CL2502
| Brand: | Abnova |
| Reference: | MAB15751 |
| Product name: | ZYX monoclonal antibody, clone CL2502 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human ZYX. |
| Clone: | CL2502 |
| Isotype: | IgG2b |
| Gene id: | 7791 |
| Gene name: | ZYX |
| Gene alias: | ESP-2|HED-2 |
| Gene description: | zyxin |
| Immunogen: | Recombinant protein corresponding to human ZYX. |
| Immunogen sequence/protein sequence: | PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNE |
| Protein accession: | Q15942 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of HeLa cells with ZYX monoclonal antibody, clone CL2502 (Cat # MAB15751) (Green) shows distinct focal adhesion. Microtubule and nuclear probes are visualized in red and blue respectively (where available). |
| Applications: | IHC-P,IF |
| Shipping condition: | Dry Ice |