TUFM monoclonal antibody, clone CL2242 View larger

TUFM monoclonal antibody, clone CL2242

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TUFM monoclonal antibody, clone CL2242

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF

More info about TUFM monoclonal antibody, clone CL2242

Brand: Abnova
Reference: MAB15734
Product name: TUFM monoclonal antibody, clone CL2242
Product description: Mouse monoclonal antibody raised against partial recombinant human TUFM.
Clone: CL2242
Isotype: IgG1
Gene id: 7284
Gene name: TUFM
Gene alias: COXPD4|EF-TuMT|EFTU|P43
Gene description: Tu translation elongation factor, mitochondrial
Immunogen: Recombinant protein corresponding to human TUFM.
Immunogen sequence/protein sequence: AVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSI
Protein accession: P49411
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15734-49-7-1.jpg
Application image note: Immunofluorescent staining of MCF7 cells with TUFM monoclonal antibody, clone CL2242 (Cat # MAB15734) (Green) shows distinct mitochondrial. Microtubule and nuclear probes are visualized in red and blue respectively (where available).
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy TUFM monoclonal antibody, clone CL2242 now

Add to cart