Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MKI67IP monoclonal antibody, clone CL2240
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF |
More info about MKI67IP monoclonal antibody, clone CL2240
| Brand: | Abnova |
| Reference: | MAB15732 |
| Product name: | MKI67IP monoclonal antibody, clone CL2240 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human MKI67IP. |
| Clone: | CL2240 |
| Isotype: | IgG2a |
| Gene id: | 84365 |
| Gene name: | MKI67IP |
| Gene alias: | NIFK|Nopp34 |
| Gene description: | MKI67 (FHA domain) interacting nucleolar phosphoprotein |
| Immunogen: | Recombinant protein corresponding to human MKI67IP. |
| Immunogen sequence/protein sequence: | IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI |
| Protein accession: | Q9BYG3 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of MCF7 cells with MKI67IP monoclonal antibody, clone CL2240 (Cat # MAB15732) (Green) shows specific nucleoli. Microtubule and nuclear probes are visualized in red and blue respectively (where available). |
| Applications: | IHC-P,IF |
| Shipping condition: | Dry Ice |