MKI67IP monoclonal antibody, clone CL2240 View larger

MKI67IP monoclonal antibody, clone CL2240

MAB15732_100 uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MKI67IP monoclonal antibody, clone CL2240

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF

More info about MKI67IP monoclonal antibody, clone CL2240

Brand: Abnova
Reference: MAB15732
Product name: MKI67IP monoclonal antibody, clone CL2240
Product description: Mouse monoclonal antibody raised against partial recombinant human MKI67IP.
Clone: CL2240
Isotype: IgG2a
Gene id: 84365
Gene name: MKI67IP
Gene alias: NIFK|Nopp34
Gene description: MKI67 (FHA domain) interacting nucleolar phosphoprotein
Immunogen: Recombinant protein corresponding to human MKI67IP.
Immunogen sequence/protein sequence: IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
Protein accession: Q9BYG3
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15732-49-7-1.jpg
Application image note: Immunofluorescent staining of MCF7 cells with MKI67IP monoclonal antibody, clone CL2240 (Cat # MAB15732) (Green) shows specific nucleoli. Microtubule and nuclear probes are visualized in red and blue respectively (where available).
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MKI67IP monoclonal antibody, clone CL2240 now

Add to cart