Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TP53 monoclonal antibody, clone CL2199
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF |
More info about TP53 monoclonal antibody, clone CL2199
| Brand: | Abnova |
| Reference: | MAB15729 |
| Product name: | TP53 monoclonal antibody, clone CL2199 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human TP53. |
| Clone: | CL2199 |
| Isotype: | IgG1 |
| Gene id: | 7157 |
| Gene name: | TP53 |
| Gene alias: | FLJ92943|LFS1|TRP53|p53 |
| Gene description: | tumor protein p53 |
| Immunogen: | Recombinant protein corresponding to human TP53. |
| Immunogen sequence/protein sequence: | KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR |
| Protein accession: | P04637 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of A431 cells with TP53 monoclonal antibody, clone CL2199 (Cat # MAB15729) (Green) shows cell cycle dependent nuclear (without nucleoli). Microtubule and nuclear probes are visualized in red and blue respectively (where available). |
| Applications: | WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | Downregulation of the cancer susceptibility protein WRAP53β in epithelial ovarian cancer leads to defective DNA repair and poor clinical outcome.Hedstrom E, Pederiva C, Farnebo J, Nodin B, Jirstrom K, Brennan DJ, Farnebo M. Cell Death Dis. 2015 Oct 1;6:e1892. doi: 10.1038/cddis.2015.250. |