Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MYH6 monoclonal antibody, clone CL2162
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P |
More info about MYH6 monoclonal antibody, clone CL2162
| Brand: | Abnova |
| Reference: | MAB15728 |
| Product name: | MYH6 monoclonal antibody, clone CL2162 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human MYH6. |
| Clone: | CL2162 |
| Isotype: | IgG2b |
| Gene id: | 4624 |
| Gene name: | MYH6 |
| Gene alias: | ASD3|MYHC|MYHCA|alpha-MHC |
| Gene description: | myosin, heavy chain 6, cardiac muscle, alpha |
| Immunogen: | Recombinant protein corresponding to human MYH6. |
| Immunogen sequence/protein sequence: | QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA |
| Protein accession: | P13533 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of human skeletal muscle tissue lysate with MYH6 monoclonal antibody, clone CL2162 (Cat # MAB15728). |
| Applications: | WB-Ti,IHC-P |
| Shipping condition: | Dry Ice |