VWF monoclonal antibody, clone CL1957 View larger

VWF monoclonal antibody, clone CL1957

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VWF monoclonal antibody, clone CL1957

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P

More info about VWF monoclonal antibody, clone CL1957

Brand: Abnova
Reference: MAB15725
Product name: VWF monoclonal antibody, clone CL1957
Product description: Mouse monoclonal antibody raised against partial recombinant human VWF.
Clone: CL1957
Isotype: IgG1
Gene id: 7450
Gene name: VWF
Gene alias: F8VWF|VWD
Gene description: von Willebrand factor
Immunogen: Recombinant protein corresponding to human VWF.
Immunogen sequence/protein sequence: ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEKT
Protein accession: P04275
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15725-47-9-1.jpg
Application image note: Western Blot analysis of human spleen tissue lysate with VWF monoclonal antibody, clone CL1957 (Cat # MAB15725).
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy VWF monoclonal antibody, clone CL1957 now

Add to cart