Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P |
Brand: | Abnova |
Reference: | MAB15723 |
Product name: | ENG monoclonal antibody, clone CL1912 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human ENG. |
Clone: | CL1912 |
Isotype: | IgG1 |
Gene id: | 2022 |
Gene name: | ENG |
Gene alias: | CD105|END|FLJ41744|HHT1|ORW|ORW1 |
Gene description: | endoglin |
Immunogen: | Recombinant protein corresponding to human ENG. |
Immunogen sequence/protein sequence: | ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK |
Protein accession: | P17813 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human renal cancer with ENG monoclonal antibody, clone CL1912 (Cat # MAB15723) shows strong immunoreactivity in the blood vessels. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |