CT83 monoclonal antibody, clone CL4762 View larger

CT83 monoclonal antibody, clone CL4762

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CT83 monoclonal antibody, clone CL4762

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about CT83 monoclonal antibody, clone CL4762

Brand: Abnova
Reference: MAB15717
Product name: CT83 monoclonal antibody, clone CL4762
Product description: Mouse monoclonal antibody raised against partial recombinant human CT83.
Clone: CL4762
Isotype: IgG1
Gene id: 203413
Gene name: CT83
Gene alias: CXorf61|KK-LC-1|KKLC1
Gene description: cancer/testis antigen 83
Immunogen: Recombinant protein corresponding to human CT83.
Immunogen sequence/protein sequence: QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Protein accession: Q5H943
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:10000-1:20000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15717-46-1-1.jpg
Application image note: Western Blot (Cell lysate) analysis of HeLa cell lysate.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CT83 monoclonal antibody, clone CL4762 now

Add to cart