NEFL monoclonal antibody, clone CL4729 View larger

NEFL monoclonal antibody, clone CL4729

MAB15716_100 uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEFL monoclonal antibody, clone CL4729

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ti,IHC-P,IF

More info about NEFL monoclonal antibody, clone CL4729

Brand: Abnova
Reference: MAB15716
Product name: NEFL monoclonal antibody, clone CL4729
Product description: Mouse monoclonal antibody raised against partial recombinant human NEFL.
Clone: CL4729
Isotype: IgG1
Gene id: 4747
Gene name: NEFL
Gene alias: CMT1F|CMT2E|FLJ53642|NF-L|NF68|NFL
Gene description: neurofilament, light polypeptide
Immunogen: Recombinant protein corresponding to human NEFL.
Immunogen sequence/protein sequence: SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF
Protein accession: P07196
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:10000-1:20000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: MAB15716-47-51-1.jpg
Application image note: Western Blot (Tissue lysate) analysis of human cerebral cortex.
Applications: WB-Ti,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy NEFL monoclonal antibody, clone CL4729 now

Add to cart