Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | MAB15713 |
Product name: | SOX2 monoclonal antibody, clone CL4716 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human SOX2. |
Clone: | CL4716 |
Isotype: | IgG1 |
Gene id: | 6657 |
Gene name: | SOX2 |
Gene alias: | ANOP3|MCOPS3|MGC2413 |
Gene description: | SRY (sex determining region Y)-box 2 |
Immunogen: | Recombinant protein corresponding to human SOX2. |
Immunogen sequence/protein sequence: | GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM |
Protein accession: | P48431 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Immunofluorescence (1-4 ug/mL) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot (Cell lysate) analysis of NTERA-2 cell lysate. |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |