METTL14 monoclonal antibody, clone CL4252 View larger

METTL14 monoclonal antibody, clone CL4252

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of METTL14 monoclonal antibody, clone CL4252

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about METTL14 monoclonal antibody, clone CL4252

Brand: Abnova
Reference: MAB15705
Product name: METTL14 monoclonal antibody, clone CL4252
Product description: Mouse monoclonal antibody raised against partial recombinant human METTL14.
Clone: CL4252
Isotype: IgG2a
Gene id: 57721
Gene name: METTL14
Gene alias: hMETTL14
Gene description: methyltransferase like 14
Immunogen: Recombinant protein corresponding to human METTL14.
Immunogen sequence/protein sequence: RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE
Protein accession: Q9HCE5
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15705-46-4-1.jpg
Application image note: Western Blot (Cell lysate) analysis of A-431 cell lysate.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy METTL14 monoclonal antibody, clone CL4252 now

Add to cart