ELTD1 monoclonal antibody, clone CL4164 View larger

ELTD1 monoclonal antibody, clone CL4164

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELTD1 monoclonal antibody, clone CL4164

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P

More info about ELTD1 monoclonal antibody, clone CL4164

Brand: Abnova
Reference: MAB15703
Product name: ELTD1 monoclonal antibody, clone CL4164
Product description: Mouse monoclonal antibody raised against partial recombinant human ELTD1.
Clone: CL4164
Isotype: IgG1
Gene id: 64123
Gene name: ELTD1
Gene alias: ETL|KPG_003
Gene description: EGF, latrophilin and seven transmembrane domain containing 1
Immunogen: Recombinant protein corresponding to human ELTD1.
Immunogen sequence/protein sequence: ENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNVCIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTIS
Protein accession: Q9HBW9
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15703-47-A8-1.jpg
Application image note: Western Blot (Tissue lysate) analysis of human placenta.
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy ELTD1 monoclonal antibody, clone CL4164 now

Add to cart