FOXJ1 monoclonal antibody, clone CL3989 View larger

FOXJ1 monoclonal antibody, clone CL3989

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXJ1 monoclonal antibody, clone CL3989

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P

More info about FOXJ1 monoclonal antibody, clone CL3989

Brand: Abnova
Reference: MAB15699
Product name: FOXJ1 monoclonal antibody, clone CL3989
Product description: Mouse monoclonal antibody raised against partial recombinant human FOXJ1.
Clone: CL3989
Isotype: IgG1
Gene id: 2302
Gene name: FOXJ1
Gene alias: FKHL13|HFH-4|HFH4|MGC35202
Gene description: forkhead box J1
Immunogen: Recombinant protein corresponding to human FOXJ1.
Immunogen sequence/protein sequence: PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Protein accession: Q92949
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15699-48-303-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human fallopian tube shows strong nuclear immunoreactivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FOXJ1 monoclonal antibody, clone CL3989 now

Add to cart